PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g20830.1.p
Common NameBRADI_1g20830, LOC100829961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 712aa    MW: 81670 Da    PI: 7.9243
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g20830.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA43.93.3e-144480135
              GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                      C  Cg +   Tp++Rrgpdg++tLCnaCG+ yrk ++
  Bradi1g20830.1.p 44 CLRCGISGnaTPHMRRGPDGPRTLCNACGIAYRKGKM 80
                      5667777777************************876 PP

2FAR183.53.5e-26114201191
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       +fYn+YA +vGFsvrks+s+ks  ++ ++ rtfvCs+eg+++++k+   +++++r  tr+gC a+l +k + + k++vt+++ eHnH+lap
  Bradi1g20830.1.p 114 EFYNKYAGHVGFSVRKSTSHKS-SEKITKVRTFVCSREGYNRDKKSL--EAKKPRLDTRIGCPARLIIKVTPECKYRVTDFKAEHNHQLAP 201
                       6********************9.5555889*************9988..99*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.09E-103990No hitNo description
SMARTSM004016.5E-64093IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.8E-114382IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.15E-84381No hitNo description
PfamPF003201.2E-114479IPR000679Zinc finger, GATA-type
PfamPF031012.1E-23114201IPR004330FAR1 DNA binding domain
PfamPF105511.5E-26324418IPR018289MULE transposase domain
PROSITE profilePS5096610.014603639IPR007527Zinc finger, SWIM-type
PfamPF044342.1E-6609638IPR007527Zinc finger, SWIM-type
SMARTSM005755.1E-6614641IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MMHMLVASDG GGGEMHPYSV VPPEQEPELP RDNADDSLDG HVRCLRCGIS GNATPHMRRG  60
PDGPRTLCNA CGIAYRKGKM RRMIEAEPPI DEASLAKLVP EVDMEFESEE KSYEFYNKYA  120
GHVGFSVRKS TSHKSSEKIT KVRTFVCSRE GYNRDKKSLE AKKPRLDTRI GCPARLIIKV  180
TPECKYRVTD FKAEHNHQLA PPSTMHMLRS QRILTELQSG EAELSDDSVA TPTTKATGDL  240
VVRQVGFLRS ISLLPADYKN YLRSKRMKAM QPGDGGAILK YLQTMQMDNP SFFYTMQIDE  300
DDKLTNFFWA DPKSRDDFNY FNDVLCLDTT YKINGYGRPL SLFLGVNHHK QTIIFGAALL  360
YDESFESFKW LFESFKIAMH GKQPAVALID QSIQLSSAMA AAWPDTSQRV CTWHVYQNSV  420
KHLNHVFQGS KTFAKDFSKC VFGYEEKEEF VFAWKSMLEK YDLRHNEWLS KLFDERERWA  480
LAYDRHIFCA DIISSLQAES FSSVLKKFLS PQLDLLSFFK HYERAVDEHR YAELQADFQA  540
SQSYPRIPPA KMLKQTSHTY TPVVFEIFRK EFELFMDSVL FSCGEAGTIS EYKVAPSEKP  600
KEHYVRFDSS DSSCICTCRK FEFMGIPCCH MLKVLDYRNI KELPQIYLLK RWRRTAKSTN  660
EDNQGHATNE KRLPLSTSVP SANHHGLQSI NARIQDTLIS NMHENPFHRS S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3583410.0AK358341.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1074F13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235320.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010235328.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLI1GS560.0I1GS56_BRADI; Uncharacterized protein
STRINGBRADI1G20830.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-112FAR1-related sequence 5